Lineage for d1psda2 (1psd A:7-107,A:296-326)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241529Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 241530Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 241554Protein Phosphoglycerate dehydrogenase [52293] (1 species)
    has additional C-terminal domain of the ferredoxin fold
  7. 241555Species Escherichia coli [TaxId:562] [52294] (1 PDB entry)
  8. 241556Domain d1psda2: 1psd A:7-107,A:296-326 [31357]
    Other proteins in same PDB: d1psda1, d1psda3, d1psdb1, d1psdb3

Details for d1psda2

PDB Entry: 1psd (more details), 2.75 Å

PDB Description: the allosteric ligand site in the vmax-type cooperative enzyme phosphoglycerate dehydrogenase

SCOP Domain Sequences for d1psda2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1psda2 c.23.12.1 (A:7-107,A:296-326) Phosphoglycerate dehydrogenase {Escherichia coli}
ekdkikfllvegvhqkaleslraagytniefhkgalddeqlkesirdahfiglrsrthlt
edvinaaeklvaigcfcigtnqvdldaaakrgipvfnapfsXstqeaqeniglevagkli
kysdngstlsavn

SCOP Domain Coordinates for d1psda2:

Click to download the PDB-style file with coordinates for d1psda2.
(The format of our PDB-style files is described here.)

Timeline for d1psda2: