![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries) |
![]() | Domain d5dq9d2: 5dq9 D:108-211 [313565] Other proteins in same PDB: d5dq9a_, d5dq9b1, d5dq9c_, d5dq9d1, d5dq9h_, d5dq9l1 automated match to d1t66c2 complexed with cl |
PDB Entry: 5dq9 (more details), 1.95 Å
SCOPe Domain Sequences for d5dq9d2:
Sequence, based on SEQRES records: (download)
>d5dq9d2 b.1.1.2 (D:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqn skdstysmsstltltkdeyerhnsytceathktstspivksfnr
>d5dq9d2 b.1.1.2 (D:108-211) automated matches {Mouse (Mus musculus) [TaxId: 10090]} radaaptvsifppsseqltsggasvvcflnnfypkdinvkwkidgserqngvlnswtdqn skdstysmsstltltkdeyerhnsytceathspivksfnr
Timeline for d5dq9d2: