SCOPe 2.08: Domain d5dq9d1: 5dq9 D:1-107

Lineage for d5dq9d1 (5dq9 D:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [188198] (836 PDB entries)

8. Domain d5dq9d1: 5dq9 D:1-107 [313564]
   Other proteins in same PDB: d5dq9a_, d5dq9b2, d5dq9c_, d5dq9d2, d5dq9h_, d5dq9l2
   automated match to d1t66c1
   complexed with cl

Details for d5dq9d1

PDB Entry: 5dq9, 1.95 Å

PDB Description: structure of s55-3 fab in complex with lipid a

PDB Compounds: (D:) MAb 44B1 light chain

SCOPe Domain Sequences for d5dq9d1:

Sequence; same for both SEQRES and ATOM records:

>d5dq9d1 b.1.1.0 (D:1-107) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
divltqspaslavslgqratifcrasetvdsygnsfmhwyqqkpgqppklliyrasnles
giparfsgsgsrtdftltinpveaddvatyycqqsnedprtfgggtkleik

Timeline for d5dq9d1:

• d5dq9d1 first appeared in SCOPe 2.06
  
• d5dq9d1 appears in SCOPe 2.07