| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5d7jb2: 5d7j B:116-242 [313559] Other proteins in same PDB: d5d7ja2, d5d7jc1, d5d7jd_, d5d7je1, d5d7jf1, d5d7jf2, d5d7jg2 automated match to d3q5ya2 complexed with 2lj, gol |
PDB Entry: 5d7j (more details), 1.97 Å
SCOPe Domain Sequences for d5d7jb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d7jb2 b.1.1.0 (B:116-242) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dlknvfppevavfepseaeishtqkatlvclatgfypdhvelswwvngkevhsgvctdpq
plkeqpalndsryalssrlrvsatfwqnprnhfrcqvqfyglsendewtqdrakpvtqiv
saeawgr
Timeline for d5d7jb2: