SCOPe 2.08: Domain d5dfsb_: 5dfs B:

Lineage for d5dfsb_ (5dfs B:)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.3: Cytochrome c [46625] (1 superfamily)
   core: 3 helices; folded leaf, opened

4. Superfamily a.3.1: Cytochrome c [46626] (9 families)
   covalently-bound heme completes the core

5. Family a.3.1.1: monodomain cytochrome c [46627] (16 proteins)

6. Protein Mitochondrial cytochrome c [46642] (7 species)

7. Species Ateles sp. [TaxId:9511] [313555] (1 PDB entry)

8. Domain d5dfsb_: 5dfs B: [313556]
   automated match to d3zooa_
   complexed with cl, edo, hec

Details for d5dfsb_

PDB Entry: 5dfs, 1.15 Å

PDB Description: crystal structure of spider monkey cytochrome c at 1.15 angstrom

PDB Compounds: (B:) cytochrome c

SCOPe Domain Sequences for d5dfsb_:

Sequence; same for both SEQRES and ATOM records:

>d5dfsb_ a.3.1.1 (B:) Mitochondrial cytochrome c {Ateles sp. [TaxId: 9511]}
gdvekgkrifimkcsqchtvekggkhktgpnlhglfgrktgqasgftyteanknkgiiwg
edtlmeylenpkkyipgtkmifvgikkkeeradliaylkkatne

Timeline for d5dfsb_:

• d5dfsb_ first appeared in SCOPe 2.06
  
• d5dfsb_ appears in SCOPe 2.07