SCOPe 2.08: Domain d5ctxa_: 5ctx A:

Lineage for d5ctxa_ (5ctx A:)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
   8-stranded mixed beta-sheet; 2 layers: alpha/beta

4. Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families)

5. Family d.122.1.0: automated matches [227160] (1 protein)
   not a true family

6. Protein automated matches [226867] (22 species)
   not a true protein

7. Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries)

8. Domain d5ctxa_: 5ctx A: [313553]
   automated match to d3u2ka_
   protein/DNA complex; complexed with 55g, mg, mpd

Details for d5ctxa_

PDB Entry: 5ctx, 1.6 Å

PDB Description: crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment

PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d5ctxa_:

Sequence; same for both SEQRES and ATOM records:

>d5ctxa_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
agqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdn
wikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvp
qfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderd
eenvredsyhye

Timeline for d5ctxa_:

• d5ctxa_ first appeared in SCOPe 2.06
  
• d5ctxa_ appears in SCOPe 2.07