Lineage for d1gdha2 (1gdh A:2-100,A:292-321)

  1. Root: SCOP 1.63
  2. 235644Class c: Alpha and beta proteins (a/b) [51349] (117 folds)
  3. 241017Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 241529Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 241530Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins)
    this domain is interrupted by the Rossmann-fold domain
  6. 241534Protein D-glycerate dehydrogenase [52291] (1 species)
  7. 241535Species Hyphomicrobium methylovorum [TaxId:84] [52292] (1 PDB entry)
  8. 241536Domain d1gdha2: 1gdh A:2-100,A:292-321 [31355]
    Other proteins in same PDB: d1gdha1, d1gdhb1

Details for d1gdha2

PDB Entry: 1gdh (more details), 2.4 Å

PDB Description: crystal structure of a nad-dependent d-glycerate dehydrogenase at 2.4 angstroms resolution

SCOP Domain Sequences for d1gdha2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1gdha2 c.23.12.1 (A:2-100,A:292-321) D-glycerate dehydrogenase {Hyphomicrobium methylovorum}
kkkilitwplpeaamararesydviahgddpkitidemietaksvdallitlnekcrkev
idripenikcistysigfdhidldackargikvgnaphgXatqaredmahqandlidalf
ggadmsyala

SCOP Domain Coordinates for d1gdha2:

Click to download the PDB-style file with coordinates for d1gdha2.
(The format of our PDB-style files is described here.)

Timeline for d1gdha2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1gdha1