![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
![]() | Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
![]() | Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins) |
![]() | Protein automated matches [190374] (15 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries) |
![]() | Domain d5d7ja2: 5d7j A:111-200 [313534] Other proteins in same PDB: d5d7ja1, d5d7jb1, d5d7jb2, d5d7jc1, d5d7jc2, d5d7jd_, d5d7je1, d5d7je2, d5d7jf1, d5d7jf2, d5d7jg1, d5d7jh1, d5d7jh2 automated match to d2f54d2 complexed with 2lj, gol |
PDB Entry: 5d7j (more details), 1.97 Å
SCOPe Domain Sequences for d5d7ja2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d7ja2 b.1.1.2 (A:111-200) automated matches {Human (Homo sapiens) [TaxId: 9606]} iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns avawsnksdfacanafnnsiipedtffpsp
Timeline for d5d7ja2: