![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
![]() | Protein Putative formate dehydrogenase [52287] (1 species) |
![]() | Species Pyrobaculum aerophilum [TaxId:13773] [52288] (1 PDB entry) |
![]() | Domain d1qp8b2: 1qp8 B:1-82,B:264-302 [31353] Other proteins in same PDB: d1qp8a1, d1qp8b1 complexed with ndp |
PDB Entry: 1qp8 (more details), 2.8 Å
SCOPe Domain Sequences for d1qp8b2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1qp8b2 c.23.12.1 (B:1-82,B:264-302) Putative formate dehydrogenase {Pyrobaculum aerophilum [TaxId: 13773]} melyvnfelppeaeeelrkyfkivrggdlgnveaalvsritaeelakmprlkfiqvvtag ldhlpwesipphvtvagnagsnXgygnervwrqmvmeavrnlityatggrprniakredy ig
Timeline for d1qp8b2: