![]() | Class b: All beta proteins [48724] (180 folds) |
![]() | Fold b.3: Prealbumin-like [49451] (8 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands to common fold |
![]() | Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families) ![]() |
![]() | Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins) automatically mapped to Pfam PF00576 |
![]() | Protein automated matches [190376] (1 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [187223] (14 PDB entries) |
![]() | Domain d5e4ob_: 5e4o B: [313526] automated match to d2roya_ complexed with l57 |
PDB Entry: 5e4o (more details), 1.5 Å
SCOPe Domain Sequences for d5e4ob_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5e4ob_ b.3.4.1 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]} cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtn
Timeline for d5e4ob_: