SCOPe 2.06: Domain d5e4oa_: 5e4o A:

Lineage for d5e4oa_ (5e4o A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.3: Prealbumin-like [49451] (7 superfamilies)
   sandwich; 7 strands in 2 sheets, greek-key
   variations: some members have additional 1-2 strands to common fold

4. Superfamily b.3.4: Transthyretin (synonym: prealbumin) [49472] (2 families)

5. Family b.3.4.1: Transthyretin (synonym: prealbumin) [49473] (2 proteins)
   automatically mapped to Pfam PF00576

6. Protein automated matches [190376] (1 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187223] (17 PDB entries)

8. Domain d5e4oa_: 5e4o A: [313525]
   automated match to d2roya_
   complexed with l57

Details for d5e4oa_

PDB Entry: 5e4o, 1.5 Å

PDB Description: human transthyretin (ttr) complexed with (z)-((3,4-dichloro-phenyl)- methyleneaminooxy)-acetic acid

PDB Compounds: (A:) Transthyretin

SCOPe Domain Sequences for d5e4oa_:

Sequence; same for both SEQRES and ATOM records:

>d5e4oa_ b.3.4.1 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
cplmvkvldavrgspainvavhvfrkaaddtwepfasgktsesgelhgltteeefvegiy
kveidtksywkalgispfhehaevvftandsgprrytiaallspysysttavvtnp

Timeline for d5e4oa_:

• d5e4oa_ is new in SCOPe 2.06-stable
  
• d5e4oa_ appears in SCOPe 2.07
  
• d5e4oa_ appears in the current release, SCOPe 2.08