Lineage for d5dfpa_ (5dfp A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2979545Fold d.144: Protein kinase-like (PK-like) [56111] (1 superfamily)
    consists of two alpha+beta domains, C-terminal domain is mostly alpha helical
  4. 2979546Superfamily d.144.1: Protein kinase-like (PK-like) [56112] (8 families) (S)
    shares functional and structural similarities with the ATP-grasp fold and PIPK
  5. 2979693Family d.144.1.7: Protein kinases, catalytic subunit [88854] (66 proteins)
    members organized in the groups and subfamiles specified by the comments
  6. 2982501Protein pak1 [56146] (1 species)
    OPK group; PAK/STE20 subfamily; serine/threonine kinase
  7. 2982502Species Human (Homo sapiens) [TaxId:9606] [56147] (19 PDB entries)
  8. 2982523Domain d5dfpa_: 5dfp A: [313521]
    automated match to d4dawa_
    complexed with 59u, dms

Details for d5dfpa_

PDB Entry: 5dfp (more details), 2.2 Å

PDB Description: crystal structure of pak1 in complex with an inhibitor compound frax1036
PDB Compounds: (A:) Serine/threonine-protein kinase PAK 1

SCOPe Domain Sequences for d5dfpa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dfpa_ d.144.1.7 (A:) pak1 {Human (Homo sapiens) [TaxId: 9606]}
sdeeileklrsivsvgdpkkkytrfekigqgasgtvytamdvatgqevairqmnlqqqpk
keliineilvmrenknpnivnyldsylvgdelwvvmeylaggsltdvvtetcmdegqiaa
vcreclqaleflhsnqvihrdiksdnillgmdgsvkltdfgfcaqitpeqskrstmvgtp
ywmapevvtrkaygpkvdiwslgimaiemiegeppylnenplralyliatngtpelqnpe
klsaifrdflnrclemdvekrgsakellqhqflkiakplssltpliaaakeat

SCOPe Domain Coordinates for d5dfpa_:

Click to download the PDB-style file with coordinates for d5dfpa_.
(The format of our PDB-style files is described here.)

Timeline for d5dfpa_: