Lineage for d1qp8a2 (1qp8 A:1-82,A:264-302)

  1. Root: SCOP 1.57
  2. 64291Class c: Alpha and beta proteins (a/b) [51349] (107 folds)
  3. 68133Fold c.23: Flavodoxin-like [52171] (17 superfamilies)
  4. 68583Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) (S)
  5. 68584Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (6 proteins)
  6. 68606Protein Putative formate dehydrogenase [52287] (1 species)
  7. 68607Species Archaeon Pyrobaculum aerophilum [TaxId:13773] [52288] (1 PDB entry)
  8. 68608Domain d1qp8a2: 1qp8 A:1-82,A:264-302 [31352]
    Other proteins in same PDB: d1qp8a1, d1qp8b1

Details for d1qp8a2

PDB Entry: 1qp8 (more details), 2.8 Å

PDB Description: crystal structure of a putative formate dehydrogenase from pyrobaculum aerophilum

SCOP Domain Sequences for d1qp8a2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1qp8a2 c.23.12.1 (A:1-82,A:264-302) Putative formate dehydrogenase {Archaeon Pyrobaculum aerophilum}
melyvnfelppeaeeelrkyfkivrggdlgnveaalvsritaeelakmprlkfiqvvtag
ldhlpwesipphvtvagnagsnXgygnervwrqmvmeavrnlityatggrprniakredy
ig

SCOP Domain Coordinates for d1qp8a2:

Click to download the PDB-style file with coordinates for d1qp8a2.
(The format of our PDB-style files is described here.)

Timeline for d1qp8a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1qp8a1