Lineage for d5d6dc1 (5d6d C:8-86)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2031996Family b.1.1.0: automated matches [191470] (1 protein)
    not a true family
  6. 2031997Protein automated matches [190740] (28 species)
    not a true protein
  7. 2032126Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)
  8. 2034356Domain d5d6dc1: 5d6d C:8-86 [313514]
    Other proteins in same PDB: d5d6da1, d5d6da2, d5d6db1, d5d6db2
    automated match to d1fnla1
    complexed with bma, fuc, ful, gal, man, nag

Details for d5d6dc1

PDB Entry: 5d6d (more details), 3.13 Å

PDB Description: crystal structure of gasdalie igg1 fc in complex with fcgriiia
PDB Compounds: (C:) Low affinity immunoglobulin gamma Fc region receptor III-A

SCOPe Domain Sequences for d5d6dc1:

Sequence, based on SEQRES records: (download)

>d5d6dc1 b.1.1.0 (C:8-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvflepqwyrvlekdsvtlkcqgayspedqstqwfhneslissqassyfidaatvddsg
eyrcqtqlstlsdpvqlev

Sequence, based on observed residues (ATOM records): (download)

>d5d6dc1 b.1.1.0 (C:8-86) automated matches {Human (Homo sapiens) [TaxId: 9606]}
avvflepqwyrvlekdsvtlkcqgatqwfhneslissqassyfidaatvddsgeyrcqtq
lsdpvqlev

SCOPe Domain Coordinates for d5d6dc1:

Click to download the PDB-style file with coordinates for d5d6dc1.
(The format of our PDB-style files is described here.)

Timeline for d5d6dc1: