Lineage for d5duvc_ (5duv C:)

  1. Root: SCOPe 2.07
  2. 2344607Class b: All beta proteins [48724] (178 folds)
  3. 2373039Fold b.29: Concanavalin A-like lectins/glucanases [49898] (1 superfamily)
    sandwich; 12-14 strands in 2 sheets; complex topology
  4. 2373040Superfamily b.29.1: Concanavalin A-like lectins/glucanases [49899] (26 families) (S)
  5. 2375103Family b.29.1.0: automated matches [191363] (1 protein)
    not a true family
  6. 2375104Protein automated matches [190437] (63 species)
    not a true protein
  7. 2375328Species Human (Homo sapiens) [TaxId:9606] [187655] (101 PDB entries)
  8. 2375417Domain d5duvc_: 5duv C: [313509]
    automated match to d2dyca_
    complexed with act, ca, lat

Details for d5duvc_

PDB Entry: 5duv (more details), 1.9 Å

PDB Description: crystal structure of the human galectin-4 n-terminal carbohydrate recognition domain in complex with lactose
PDB Compounds: (C:) Galectin-4

SCOPe Domain Sequences for d5duvc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5duvc_ b.29.1.0 (C:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ptlpyyqpipgglnvgmsvyiqgvasehmkrffvnfvvgqdpgsdvafhfnprfdgwdkv
vfntlqggkwgseerkrsmpfkkgaafelvfivlaehykvvvngnpfyeyghrlplqmvt
hlqvdgdlqlqsinfig

SCOPe Domain Coordinates for d5duvc_:

Click to download the PDB-style file with coordinates for d5duvc_.
(The format of our PDB-style files is described here.)

Timeline for d5duvc_: