Lineage for d5d7ig2 (5d7i G:111-198)

  1. Root: SCOPe 2.06
  2. 2021373Class b: All beta proteins [48724] (177 folds)
  3. 2021374Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2021375Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2025133Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2029182Protein automated matches [190374] (16 species)
    not a true protein
  7. 2029210Species Human (Homo sapiens) [TaxId:9606] [187221] (698 PDB entries)
  8. 2029680Domain d5d7ig2: 5d7i G:111-198 [313508]
    Other proteins in same PDB: d5d7ia1, d5d7ia2, d5d7ib_, d5d7ic1, d5d7ic2, d5d7id_, d5d7ie1, d5d7if1, d5d7if2, d5d7ig1, d5d7ih1, d5d7ih2
    automated match to d2f54d2
    complexed with 30w, gol, pro

Details for d5d7ig2

PDB Entry: 5d7i (more details), 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr
PDB Compounds: (G:) M33.64 TCR Alpha Chain

SCOPe Domain Sequences for d5d7ig2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5d7ig2 b.1.1.2 (G:111-198) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffp

SCOPe Domain Coordinates for d5d7ig2:

Click to download the PDB-style file with coordinates for d5d7ig2.
(The format of our PDB-style files is described here.)

Timeline for d5d7ig2: