SCOPe 2.06: Domain d5d7ig1: 5d7i G:1-110

Lineage for d5d7ig1 (5d7i G:1-110)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (28 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187920] (935 PDB entries)

8. Domain d5d7ig1: 5d7i G:1-110 [313507]
   Other proteins in same PDB: d5d7ia1, d5d7ib_, d5d7ic1, d5d7id_, d5d7ie2, d5d7ig2
   automated match to d2f54d1
   complexed with 30w, gol, pro

Details for d5d7ig1

PDB Entry: 5d7i, 2 Å

PDB Description: structure of human mr1-ac-6-fp in complex with human mait m33.64 tcr

PDB Compounds: (G:) M33.64 TCR Alpha Chain

SCOPe Domain Sequences for d5d7ig1:

Sequence; same for both SEQRES and ATOM records:

>d5d7ig1 b.1.1.0 (G:1-110) automated matches {Human (Homo sapiens) [TaxId: 9606]}
gqnidqptemtategaivqinctyqtsgfnglfwyqqhageaptflsynvldgleekgrf
ssflsrskgysylllkelqmkdsasylcavmdsnyqliwgagtkliikpd

Timeline for d5d7ig1:

• d5d7ig1 is new in SCOPe 2.06-stable
  
• d5d7ig1 appears in SCOPe 2.07
  
• d5d7ig1 appears in the current release, SCOPe 2.08