![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.12: Formate/glycerate dehydrogenase catalytic domain-like [52283] (3 families) ![]() |
![]() | Family c.23.12.1: Formate/glycerate dehydrogenases, substrate-binding domain [52284] (7 proteins) this domain is interrupted by the Rossmann-fold domain |
![]() | Protein Formate dehydrogenase [52285] (1 species) contains an additional beta-hairpin after the common fold |
![]() | Species Pseudomonas sp., strain 101 [TaxId:306] [52286] (2 PDB entries) |
![]() | Domain d2nacb2: 2nac B:1-147,B:336-374 [31349] Other proteins in same PDB: d2naca1, d2nacb1 complexed with so4 |
PDB Entry: 2nac (more details), 1.8 Å
SCOPe Domain Sequences for d2nacb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d2nacb2 c.23.12.1 (B:1-147,B:336-374) Formate dehydrogenase {Pseudomonas sp., strain 101 [TaxId: 306]} akvlcvlyddpvdgypktyarddlpkidhypggqtlptpkaidftpgqllgsvsgelglr kylesnghtlvvtsdkdgpdsvferelvdadvvisqpfwpayltperiakaknlklalta gigsdhvdlqsaidrnvtvaevtycnsXttltaqaryaagtreilecffegrpirdeyli vqggala
Timeline for d2nacb2: