Lineage for d5d7kd2 (5d7k D:111-199)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2739517Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2739518Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2745637Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)
  6. 2749859Protein automated matches [190374] (15 species)
    not a true protein
  7. 2749887Species Human (Homo sapiens) [TaxId:9606] [187221] (1251 PDB entries)
  8. 2750446Domain d5d7kd2: 5d7k D:111-199 [313480]
    Other proteins in same PDB: d5d7kd1, d5d7ke1, d5d7ke2
    automated match to d2pyfa2
    complexed with so4

Details for d5d7kd2

PDB Entry: 5d7k (more details), 1.9 Å

PDB Description: structure of mr1-reactive mav36 tcr
PDB Compounds: (D:) MAV36 TCR Alpha Chain

SCOPe Domain Sequences for d5d7kd2:

Sequence, based on SEQRES records: (download)

>d5d7kd2 b.1.1.2 (D:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdskssdksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksns
avawsnksdfacanafnnsiipedtffps

Sequence, based on observed residues (ATOM records): (download)

>d5d7kd2 b.1.1.2 (D:111-199) automated matches {Human (Homo sapiens) [TaxId: 9606]}
iqnpdpavyqlrdsksksvclftdfdsqtnvsqskdsdvyitdkcvldmrsmdfksnsav
awsnksdfacanafnnsiipedtffps

SCOPe Domain Coordinates for d5d7kd2:

Click to download the PDB-style file with coordinates for d5d7kd2.
(The format of our PDB-style files is described here.)

Timeline for d5d7kd2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5d7kd1