| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries) |
| Domain d5drnb2: 5drn B:108-211 [313451] automated match to d4ztpl2 complexed with 5ct, gol |
PDB Entry: 5drn (more details), 1.99 Å
SCOPe Domain Sequences for d5drnb2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5drnb2 b.1.1.0 (B:108-211) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
gdpvaptvlifppaadqvatgtvtivcvankyfpdvtvtwevdgttqttgiensktpqns
adctynlsstltltstqynshkeytckvtqgttsvvqsfnrgdc
Timeline for d5drnb2:
View in 3DDomains from other chains: (mouse over for more information) d5drna_, d5drnh_, d5drnl1, d5drnl2 |