SCOPe 2.08: Domain d5drnb1: 5drn B:1-107

Lineage for d5drnb1 (5drn B:1-107)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.0: automated matches [191470] (1 protein)
   not a true family

6. Protein automated matches [190740] (31 species)
   not a true protein

7. Species Rabbit (Oryctolagus cuniculus) [TaxId:9986] [225523] (30 PDB entries)

8. Domain d5drnb1: 5drn B:1-107 [313450]
   automated match to d4jo4l1
   complexed with 5ct, gol

Details for d5drnb1

PDB Entry: 5drn, 1.99 Å

PDB Description: context-independent anti-hypusine antibody fabhpu24 in complex with hypusine

PDB Compounds: (B:) Fab Hpu24 Light chain

SCOPe Domain Sequences for d5drnb1:

Sequence; same for both SEQRES and ATOM records:

>d5drnb1 b.1.1.0 (B:1-107) automated matches {Rabbit (Oryctolagus cuniculus) [TaxId: 9986]}
aavltqtpspvsaavggtvtiscqssetvyrgdwlswfqkkpgqppklliydasylasgv
ssrfsgsgsgthftltisgvqcddaatyyclggyyddaddtfgggtevvvk

Timeline for d5drnb1:

• d5drnb1 first appeared in SCOPe 2.06
  
• d5drnb1 appears in SCOPe 2.07