SCOPe 2.08: Domain d5du6c1: 5du6 C:1-243

Lineage for d5du6c1 (5du6 C:1-243)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.14: ClpP/crotonase [52095] (1 superfamily)
   core: 4 turns of (beta-beta-alpha)n superhelix

4. Superfamily c.14.1: ClpP/crotonase [52096] (5 families)

5. Family c.14.1.0: automated matches [191346] (1 protein)
   not a true family

6. Protein automated matches [190246] (71 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:1773] [189677] (9 PDB entries)

8. Domain d5du6c1: 5du6 C:1-243 [313448]
   Other proteins in same PDB: d5du6a2, d5du6b2, d5du6c2
   automated match to d3he2a_
   complexed with g59

Details for d5du6c1

PDB Entry: 5du6, 2.61 Å

PDB Description: crystal structure of m. tuberculosis echa6 bound to ligand gsk059a.

PDB Compounds: (C:) Probable enoyl-CoA hydratase echA6

SCOPe Domain Sequences for d5du6c1:

Sequence; same for both SEQRES and ATOM records:

>d5du6c1 c.14.1.0 (C:1-243) automated matches {Mycobacterium tuberculosis [TaxId: 1773]}
migitqaeavltielqrperrnalnsqlveeltqairkagdgsaraivltgqgtafcaga
dlsgdafaadypdrlielhkamdaspmpvvgaingpaigaglqlamqcdlrvvapdaffq
fptskyglaldnwsirrlsslvghgraramllsaekltaeialhtgmanrigtladaqaw
aaeiarlaplaiqhakrvlnddgaieeawpahkelfdkawgsqdvieaqvarmekrppkf
qga

Timeline for d5du6c1:

• d5du6c1 first appeared in SCOPe 2.06
  
• d5du6c1 appears in SCOPe 2.07