| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.1: Immunoglobulin [48726] (5 families) ![]() |
| Family b.1.1.0: automated matches [191470] (1 protein) not a true family |
| Protein automated matches [190740] (31 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [187920] (1793 PDB entries) |
| Domain d5d5mc2: 5d5m C:179-269 [313447] Other proteins in same PDB: d5d5ma1, d5d5mb_, d5d5mc1, d5d5md1, d5d5md2, d5d5me2, d5d5mg2 automated match to d4l4va2 complexed with 2lj, act, gol |
PDB Entry: 5d5m (more details), 2.2 Å
SCOPe Domain Sequences for d5d5mc2:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d5mc2 b.1.1.0 (C:179-269) automated matches {Human (Homo sapiens) [TaxId: 9606]}
tepplvrvnrketfpgvtalfckahgfyppeiymtwmkngeeivqeidygdilpsgdgty
qawasieldpqssnlyschvehsgvhmvlqv
Timeline for d5d5mc2: