Lineage for d5dkqa_ (5dkq A:)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 1996349Fold a.39: EF Hand-like [47472] (4 superfamilies)
    core: 4 helices; array of 2 hairpins, opened
  4. 1996350Superfamily a.39.1: EF-hand [47473] (12 families) (S)
    Duplication: consists of two EF-hand units: each is made of two helices connected with calcium-binding loop
  5. 1996383Family a.39.1.2: S100 proteins [47478] (2 proteins)
    dimer: subunits are made of two EF-hands
  6. 1996384Protein Calcyclin (S100) [47479] (17 species)
  7. 1996385Species Cow (Bos taurus), s100b [TaxId:9913] [47482] (26 PDB entries)
  8. 1996401Domain d5dkqa_: 5dkq A: [313443]
    automated match to d1cfpa_
    complexed with 5d0, ca

Details for d5dkqa_

PDB Entry: 5dkq (more details), 1.59 Å

PDB Description: crystal structure of calcium-loaded s100b bound to sbi4214
PDB Compounds: (A:) Protein S100-B

SCOPe Domain Sequences for d5dkqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5dkqa_ a.39.1.2 (A:) Calcyclin (S100) {Cow (Bos taurus), s100b [TaxId: 9913]}
mselekavvalidvfhqysgregdkhklkkselkelinnelshfleeikeqevvdkvmet
ldsdgdgecdfqefmafvamittacheffeh

SCOPe Domain Coordinates for d5dkqa_:

Click to download the PDB-style file with coordinates for d5dkqa_.
(The format of our PDB-style files is described here.)

Timeline for d5dkqa_: