![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.66: S-adenosyl-L-methionine-dependent methyltransferases [53334] (1 superfamily) core: 3 layers, a/b/a; mixed beta-sheet of 7 strands, order 3214576; strand 7 is antiparallel to the rest |
![]() | Superfamily c.66.1: S-adenosyl-L-methionine-dependent methyltransferases [53335] (61 families) ![]() |
![]() | Family c.66.1.6: Arginine methyltransferase [53351] (5 proteins) lacks the last two strands of the common fold replaced with a beta-sandwich oligomerisation subdomain |
![]() | Protein automated matches [254715] (3 species) not a true protein |
![]() | Species Human (Homo sapiens) [TaxId:9606] [313441] (18 PDB entries) |
![]() | Domain d5dstd_: 5dst D: [313442] automated match to d1orha_ complexed with sah |
PDB Entry: 5dst (more details), 2.96 Å
SCOPe Domain Sequences for d5dstd_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dstd_ c.66.1.6 (D:) automated matches {Human (Homo sapiens) [TaxId: 9606]} syahfgiheemlkdevrtltyrnsmyhnkhvfkdkvvldvgsgtgilsmfaakagakkvf giecssisdysekiikanhldniitifkgkveevelpvekvdiiisewmgyclfyesmln tvifardkwlkpgglmfpdraalyvvaiedrqykdfkihwwenvygfdmtcirdvamkep lvdivdpkqvvtnaclikevdiytvkteelsftsafclqiqrndyvhalvtyfnieftkc hkkmgfstapdapythwkqtvfyledyltvrrgeeiygtismkpnaknvrdldftvdldf kgqlcetsvsndykmr
Timeline for d5dstd_: