Lineage for d1bwr__ (1bwr -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.10: Esterase/acetylhydrolase [52266] (4 families) 
Family c.23.10.3: Acetylhydrolase [52273] (1 protein) Protein Platelet-activating factor acetylhydrolase [52274] (1 species) Species Cow (Bos taurus) [TaxId:9913] [52275] (5 PDB entries) 
Domain d1bwr__: 1bwr - [31344]
Details for d1bwr__
PDB Entry: 1bwr (more details), 2.4 Å
PDB Description: probing the substrate specificity of the intracellular brain platelet- activating factor acetylhydrolase
SCOP Domain Sequences for d1bwr__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwr__ c.23.10.3 (-) Platelet-activating factor acetylhydrolase {Cow (Bos taurus)}
enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgsnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydylhlsrlgytpvcralhslllrll
SCOP Domain Coordinates for d1bwr__:
Click to download the PDB-style file with coordinates for d1bwr__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bwr__:
- d1bwr__ appears in SCOP 1.57
- d1bwr__ appears in the current release, SCOPe 2.08, called d1bwra_
View in 3D