Lineage for d5do9f1 (5do9 F:42-173)

  1. Root: SCOPe 2.08
  2. 2685877Class a: All alpha proteins [46456] (290 folds)
  3. 2719790Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
    multihelical; consists of two all-alpha subdomains
    contains a 4-helical bundle with left-handed twist and up-and-down topology
  4. 2719791Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families) (S)
  5. 2719852Family a.91.1.0: automated matches [191379] (1 protein)
    not a true family
  6. 2719853Protein automated matches [190464] (3 species)
    not a true protein
  7. 2719862Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)
  8. 2719894Domain d5do9f1: 5do9 F:42-173 [313436]
    Other proteins in same PDB: d5do9b2, d5do9d2, d5do9f2
    automated match to d2bv1a_
    complexed with alf, gdp, mg

Details for d5do9f1

PDB Entry: 5do9 (more details), 2.6 Å

PDB Description: structure of regulator of g protein signaling 8 (rgs8) in complex with alf4-activated galpha-q
PDB Compounds: (F:) Regulator of G-protein signaling 8

SCOPe Domain Sequences for d5do9f1:

Sequence; same for both SEQRES and ATOM records: (download)

>d5do9f1 a.91.1.0 (F:42-173) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkrlsteeatrwadsfdvllshkygvaafraflktefseenlefwlaceefkktrstakl
vskahrifeefvdvqaprevnidfqtreatrknlqepsltcfdqaqgkvhslmekdsypr
flrskmyldlls

SCOPe Domain Coordinates for d5do9f1:

Click to download the PDB-style file with coordinates for d5do9f1.
(The format of our PDB-style files is described here.)

Timeline for d5do9f1: