Lineage for d5aekn_ (5aek N:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2538334Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
    core: beta(2)-alpha-beta(2); mixed beta-sheet 2143
  4. 2538335Superfamily d.15.1: Ubiquitin-like [54236] (11 families) (S)
  5. 2540226Family d.15.1.0: automated matches [191343] (1 protein)
    not a true family
  6. 2540227Protein automated matches [190233] (31 species)
    not a true protein
  7. 2540283Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)
  8. 2540487Domain d5aekn_: 5aek N: [313435]
    Other proteins in same PDB: d5aeka_, d5aekc_, d5aeke_, d5aekg_, d5aeki_, d5aekk_, d5aekm_, d5aeko_, d5aekq_, d5aeks_, d5aeku_, d5aekw_
    automated match to d2vrrb_

Details for d5aekn_

PDB Entry: 5aek (more details), 3 Å

PDB Description: crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w
PDB Compounds: (N:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d5aekn_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aekn_ d.15.1.0 (N:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
lgmeeedvievyqeqtgg

SCOPe Domain Coordinates for d5aekn_:

Click to download the PDB-style file with coordinates for d5aekn_.
(The format of our PDB-style files is described here.)

Timeline for d5aekn_: