SCOPe 2.07: Domain d5aekx_: 5aek X:

Lineage for d5aekx_ (5aek X:)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.15: beta-Grasp (ubiquitin-like) [54235] (14 superfamilies)
   core: beta(2)-alpha-beta(2); mixed beta-sheet 2143

4. Superfamily d.15.1: Ubiquitin-like [54236] (11 families)

5. Family d.15.1.0: automated matches [191343] (1 protein)
   not a true family

6. Protein automated matches [190233] (31 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187090] (152 PDB entries)

8. Domain d5aekx_: 5aek X: [313433]
   Other proteins in same PDB: d5aeka_, d5aekc_, d5aeke_, d5aekg_, d5aeki_, d5aekk_, d5aekm_, d5aeko_, d5aekq_, d5aeks_, d5aeku_, d5aekw_
   automated match to d2vrrb_

Details for d5aekx_

PDB Entry: 5aek, 3 Å

PDB Description: crystal structure of the human senp2 c548s in complex with the human sumo1 k48m f66w

PDB Compounds: (X:) Small ubiquitin-related modifier 1

SCOPe Domain Sequences for d5aekx_:

Sequence; same for both SEQRES and ATOM records:

>d5aekx_ d.15.1.0 (X:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
eyiklkvigqdsseihfkvkmtthlkklmesycqrqgvpmnslrflwegqriadnhtpke
lgmeeedvievyqeqtgg

Timeline for d5aekx_:

• d5aekx_ first appeared in SCOPe 2.06
  
• d5aekx_ appears in the current release, SCOPe 2.08