SCOPe 2.08: Domain d5do9d1: 5do9 D:42-173

Lineage for d5do9d1 (5do9 D:42-173)

1. Root: SCOPe 2.08

2. Class a: All alpha proteins [46456] (290 folds)

3. Fold a.91: Regulator of G-protein signaling, RGS [48096] (1 superfamily)
   multihelical; consists of two all-alpha subdomains
   contains a 4-helical bundle with left-handed twist and up-and-down topology

4. Superfamily a.91.1: Regulator of G-protein signaling, RGS [48097] (2 families)

5. Family a.91.1.0: automated matches [191379] (1 protein)
   not a true family

6. Protein automated matches [190464] (3 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [187381] (38 PDB entries)

8. Domain d5do9d1: 5do9 D:42-173 [313432]
   Other proteins in same PDB: d5do9b2, d5do9d2, d5do9f2
   automated match to d2bv1a_
   complexed with alf, gdp, mg

Details for d5do9d1

PDB Entry: 5do9, 2.6 Å

PDB Description: structure of regulator of g protein signaling 8 (rgs8) in complex with alf4-activated galpha-q

PDB Compounds: (D:) Regulator of G-protein signaling 8

SCOPe Domain Sequences for d5do9d1:

Sequence; same for both SEQRES and ATOM records:

>d5do9d1 a.91.1.0 (D:42-173) automated matches {Human (Homo sapiens) [TaxId: 9606]}
lkrlsteeatrwadsfdvllshkygvaafraflktefseenlefwlaceefkktrstakl
vskahrifeefvdvqaprevnidfqtreatrknlqepsltcfdqaqgkvhslmekdsypr
flrskmyldlls

Timeline for d5do9d1:

• d5do9d1 first appeared in SCOPe 2.06
  
• d5do9d1 appears in SCOPe 2.07