Lineage for d1bwqa_ (1bwq A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857391Family c.23.10.3: Acetylhydrolase [52273] (3 proteins)
  6. 2857392Protein Platelet-activating factor acetylhydrolase [52274] (2 species)
  7. 2857393Species Cow (Bos taurus), alpha1 [TaxId:9913] [52275] (6 PDB entries)
  8. 2857398Domain d1bwqa_: 1bwq A: [31343]

Details for d1bwqa_

PDB Entry: 1bwq (more details), 2.3 Å

PDB Description: probing the substrate specificity of the intracellular brain platelet- activating factor acetylhydrolase
PDB Compounds: (A:) platelet-activating factor acetylhydrolase

SCOPe Domain Sequences for d1bwqa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1bwqa_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha1 [TaxId: 9913]}
enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydyahlsrlgytpvcralhslllrll

SCOPe Domain Coordinates for d1bwqa_:

Click to download the PDB-style file with coordinates for d1bwqa_.
(The format of our PDB-style files is described here.)

Timeline for d1bwqa_: