Lineage for d1bwqa_ (1bwq A:)
- Root: SCOPe 2.08
Class c: Alpha and beta proteins (a/b) [51349] (148 folds) 
Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
Superfamily c.23.10: SGNH hydrolase [52266] (10 families) 
Family c.23.10.3: Acetylhydrolase [52273] (3 proteins) Protein Platelet-activating factor acetylhydrolase [52274] (2 species) Species Cow (Bos taurus), alpha1 [TaxId:9913] [52275] (6 PDB entries) 
Domain d1bwqa_: 1bwq A: [31343]
Details for d1bwqa_
PDB Entry: 1bwq (more details), 2.3 Å
PDB Description: probing the substrate specificity of the intracellular brain platelet- activating factor acetylhydrolase
PDB Compounds: (A:) platelet-activating factor acetylhydrolaseSCOPe Domain Sequences for d1bwqa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwqa_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha1 [TaxId: 9913]}
enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydyahlsrlgytpvcralhslllrll
SCOPe Domain Coordinates for d1bwqa_:
Click to download the PDB-style file with coordinates for d1bwqa_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1bwqa_:
- d1bwqa_ first appeared (with stable ids) in SCOP 1.55, called d1bwq__
- d1bwqa_ appears in SCOPe 2.07
View in 3D