Lineage for d1wab__ (1wab -)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22164Superfamily c.23.10: Esterase/acetylhydrolase [52266] (4 families) (S)
  5. 22177Family c.23.10.3: Acetylhydrolase [52273] (1 protein)
  6. 22178Protein Platelet-activating factor acetylhydrolase [52274] (1 species)
  7. 22179Species Cow (Bos taurus) [TaxId:9913] [52275] (5 PDB entries)
  8. 22181Domain d1wab__: 1wab - [31341]

Details for d1wab__

PDB Entry: 1wab (more details), 1.7 Å

PDB Description: platelet-activating factor acetylhydrolase

SCOP Domain Sequences for d1wab__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1wab__ c.23.10.3 (-) Platelet-activating factor acetylhydrolase {Cow (Bos taurus)}
enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydylhlsrlgytpvcralhslllrll

SCOP Domain Coordinates for d1wab__:

Click to download the PDB-style file with coordinates for d1wab__.
(The format of our PDB-style files is described here.)

Timeline for d1wab__: