![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.23: Flavodoxin-like [52171] (15 superfamilies) 3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345 |
![]() | Superfamily c.23.10: SGNH hydrolase [52266] (10 families) ![]() |
![]() | Family c.23.10.3: Acetylhydrolase [52273] (3 proteins) |
![]() | Protein Platelet-activating factor acetylhydrolase [52274] (2 species) |
![]() | Species Cow (Bos taurus), alpha1 [TaxId:9913] [52275] (6 PDB entries) |
![]() | Domain d1waba_: 1wab A: [31341] complexed with act |
PDB Entry: 1wab (more details), 1.7 Å
SCOPe Domain Sequences for d1waba_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1waba_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha1 [TaxId: 9913]} enpaskptpvqdvqgdgrwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt ishhdmydylhlsrlgytpvcralhslllrll
Timeline for d1waba_: