Lineage for d5aewo2 (5aew O:180-459)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2975208Fold d.129: TBP-like [55944] (11 superfamilies)
    beta-alpha-beta(4)-alpha
  4. 2975504Superfamily d.129.3: Bet v1-like [55961] (11 families) (S)
    contains a single copy of this fold with a alpha-beta2 insertion after the first helix; there is a cavity between the beta-sheet and the long C-terminal helix
  5. 2975906Family d.129.3.0: automated matches [191339] (1 protein)
    not a true family
  6. 2975907Protein automated matches [190218] (21 species)
    not a true protein
  7. 2975910Species Burkholderia xenovorans [TaxId:266265] [226024] (9 PDB entries)
  8. 2975948Domain d5aewo2: 5aew O:180-459 [313409]
    Other proteins in same PDB: d5aewa1, d5aewb_, d5aewc1, d5aewd_, d5aewe1, d5aewf_, d5aewg1, d5aewh_, d5aewi1, d5aewj_, d5aewk1, d5aewl_, d5aewm1, d5aewn_, d5aewo1, d5aewp_, d5aewq1, d5aewr_, d5aews1, d5aewt_, d5aewu1, d5aewv_, d5aeww1, d5aewx_
    automated match to d2xr8a2
    complexed with bnl, fe2, fes

Details for d5aewo2

PDB Entry: 5aew (more details), 1.88 Å

PDB Description: crystal structure of ii9 variant of biphenyl dioxygenase from burkholderia xenovorans lb400 in complex with biphenyl
PDB Compounds: (O:) Biphenyl dioxygenase subunit alpha

SCOPe Domain Sequences for d5aewo2:

Sequence; same for both SEQRES and ATOM records: (download)

>d5aewo2 d.129.3.0 (O:180-459) automated matches {Burkholderia xenovorans [TaxId: 266265]}
apdletylgdarpymdvmldrtpagtvaiggmqkwvipcnwkfaaeqfcsdmyhagttth
lsgilagippemdlsqaqiptkgnqfraawgghgsgwyvdepgsllavmgpkvtqywteg
paaelaeqrlghtgmpvrrmvgqhmtifptcsflpgintirtwhprgpneievwaftlvd
adapaeikeeyrrhnirnfsaggvfeqddgenwveiqkglrgykaksqplnaqmglgrsq
tghpdfpgnvgyvyaeeaargmyhhwmrmmsepswatlkp

SCOPe Domain Coordinates for d5aewo2:

Click to download the PDB-style file with coordinates for d5aewo2.
(The format of our PDB-style files is described here.)

Timeline for d5aewo2: