Lineage for d1es9a_ (1es9 A:)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.10: Esterase/acetylhydrolase [52266] (4 families) 
Family c.23.10.3: Acetylhydrolase [52273] (1 protein) Protein Platelet-activating factor acetylhydrolase [52274] (1 species) Species Cow (Bos taurus) [TaxId:9913] [52275] (5 PDB entries) 
Domain d1es9a_: 1es9 A: [31340]
Details for d1es9a_
PDB Entry: 1es9 (more details), 1.3 Å
PDB Description: x-ray crystal structure of r22k mutant of the mammalian brain platelet-activating factor acetylhydrolases (paf-ah)
SCOP Domain Sequences for d1es9a_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1es9a_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus)}
enpaskptpvqdvqgdgkwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydylhlsrlgytpvcralhslllrll
SCOP Domain Coordinates for d1es9a_:
Click to download the PDB-style file with coordinates for d1es9a_.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1es9a_:
- d1es9a_ appears in SCOP 1.57
- d1es9a_ appears in the current release, SCOPe 2.08
View in 3D