Lineage for d1es9a_ (1es9 A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857391Family c.23.10.3: Acetylhydrolase [52273] (3 proteins)
  6. 2857392Protein Platelet-activating factor acetylhydrolase [52274] (2 species)
  7. 2857393Species Cow (Bos taurus), alpha1 [TaxId:9913] [52275] (6 PDB entries)
  8. 2857394Domain d1es9a_: 1es9 A: [31340]
    mutant

Details for d1es9a_

PDB Entry: 1es9 (more details), 1.3 Å

PDB Description: x-ray crystal structure of r22k mutant of the mammalian brain platelet-activating factor acetylhydrolases (paf-ah)
PDB Compounds: (A:) platelet-activating factor acetylhydrolase ib gamma subunit

SCOPe Domain Sequences for d1es9a_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1es9a_ c.23.10.3 (A:) Platelet-activating factor acetylhydrolase {Cow (Bos taurus), alpha1 [TaxId: 9913]}
enpaskptpvqdvqgdgkwmslhhrfvadskdkepevvfigdslvqlmhqceiwrelfsp
lhalnfgiggdstqhvlwrlengelehirpkivvvwvgtnnhghtaeqvtggikaivqlv
nerqpqarvvvlgllprgqhpnplreknrrvnelvraalaghprahfldadpgfvhsdgt
ishhdmydylhlsrlgytpvcralhslllrll

SCOPe Domain Coordinates for d1es9a_:

Click to download the PDB-style file with coordinates for d1es9a_.
(The format of our PDB-style files is described here.)

Timeline for d1es9a_: