Lineage for d5d4yb_ (5d4y B:)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2413227Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies)
    contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678
    the first seven superfamilies have similar phosphate-binding sites
  4. 2416558Superfamily c.1.8: (Trans)glycosidases [51445] (15 families) (S)
  5. 2418840Family c.1.8.0: automated matches [191314] (1 protein)
    not a true family
  6. 2418841Protein automated matches [190075] (97 species)
    not a true protein
  7. 2419172Species Goat (Capra hircus) [TaxId:9925] [313362] (1 PDB entry)
  8. 2419174Domain d5d4yb_: 5d4y B: [313376]
    automated match to d2depb_
    complexed with bxp

Details for d5d4yb_

PDB Entry: 5d4y (more details), 2.5 Å

PDB Description: a psychrophilic glycoside hydrolase family 10 endo-beta-1,4-xylanase
PDB Compounds: (B:) xylanase

SCOPe Domain Sequences for d5d4yb_:

Sequence, based on SEQRES records: (download)

>d5d4yb_ c.1.8.0 (B:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
glkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenamkpqptepkkgefnweda
dkiadfcrangikmrghtlmwhsqigswmyqdekgnllskeefyanmkhhiqaivnrykd
vvycwdvvneavadspvypgrpelrnspmyqiageefiykafeyaheadpdallfyndyn
daepaksqriynlvkrmkdagvpidgigmqahynvygptmkevddaiklystvvdhihlt
eldirinedmggglrfnqgqatvsdwertlqqdqyvqlfkvlrkhkdvidcvtfwnvsdk
dswlgvrnypllfdenykpkqaynavknf

Sequence, based on observed residues (ATOM records): (download)

>d5d4yb_ c.1.8.0 (B:) automated matches {Goat (Capra hircus) [TaxId: 9925]}
glkdaykdyfkigvavnnrnvadpdqikvvlrefnsitaenamkpqptepkkgefnweda
dkiadfcrangikmrghtlmwhsqigswmyqkgnllskeefyanmkhhiqaivnrykdvv
ycwdvvneavadspvypgrpelrnspmyqiageefiykafeyaheadpdallfyndynda
epaksqriynlvkrmkdagvpidgigmqahynvygptmkevddaiklystvvdhihltel
dirinvsdwertlqqdqyvqlfkvlrkhkdvidcvtfwnvsdkdswlgvrnypllfdeny
kpkqaynavknf

SCOPe Domain Coordinates for d5d4yb_:

Click to download the PDB-style file with coordinates for d5d4yb_.
(The format of our PDB-style files is described here.)

Timeline for d5d4yb_:

View in 3D
Domains from other chains:
(mouse over for more information)
d5d4ya_