SCOPe 2.08: Domain d5d7je1: 5d7j E:1-178

Lineage for d5d7je1 (5d7j E:1-178)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.19: MHC antigen-recognition domain [54451] (1 superfamily)
   dimeric

4. Superfamily d.19.1: MHC antigen-recognition domain [54452] (2 families)

5. Family d.19.1.0: automated matches [227140] (1 protein)
   not a true family

6. Protein automated matches [226842] (5 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [226044] (107 PDB entries)

8. Domain d5d7je1: 5d7j E:1-178 [313373]
   Other proteins in same PDB: d5d7ja1, d5d7ja2, d5d7jb1, d5d7jb2, d5d7jc2, d5d7jd_, d5d7je2, d5d7jf1, d5d7jf2, d5d7jg1, d5d7jg2, d5d7jh1, d5d7jh2
   automated match to d4l4va1
   complexed with 2lj, gol

Details for d5d7je1

PDB Entry: 5d7j, 1.97 Å

PDB Description: structure of human mr1-5-op-ru in complex with human mait m33.64(y95alphaf) tcr

PDB Compounds: (E:) Major histocompatibility complex class I-related gene protein

SCOPe Domain Sequences for d5d7je1:

Sequence; same for both SEQRES and ATOM records:

>d5d7je1 d.19.1.0 (E:1-178) automated matches {Human (Homo sapiens) [TaxId: 9606]}
rthslryfrlgvsdpihgvpefisvgyvdshpittydsvtrqkeprapwmaenlapdhwe
rytqllrgwqqmfkvelkrlqrhynhsgshtyqrmigcelledgsttgflqyaydgqdfl
ifnkdtlswlavdnvahtikqaweanqhellyqknwleeeciawlkrfleygkdtlqr

Timeline for d5d7je1:

• d5d7je1 first appeared in SCOPe 2.06
  
• d5d7je1 appears in SCOPe 2.07