| Class b: All beta proteins [48724] (180 folds) |
| Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies) sandwich; 7 strands in 2 sheets; greek-key some members of the fold have additional strands |
Superfamily b.1.2: Fibronectin type III [49265] (2 families) ![]() |
| Family b.1.2.0: automated matches [191562] (1 protein) not a true family |
| Protein automated matches [190976] (5 species) not a true protein |
| Species Human (Homo sapiens) [TaxId:9606] [188649] (69 PDB entries) |
| Domain d5dc9b_: 5dc9 B: [313372] Other proteins in same PDB: d5dc9a_ automated match to d3k2mc_ complexed with gol, imd |
PDB Entry: 5dc9 (more details), 1.56 Å
SCOPe Domain Sequences for d5dc9b_:
Sequence; same for both SEQRES and ATOM records: (download)
>d5dc9b_ b.1.2.0 (B:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
svsdvptklevvaatptslliswdapavtvdyyvitygetggwsgyqefevpgskstati
sglspgvdytitvyaygypyvkynkspisinyrt
Timeline for d5dc9b_: