Lineage for d5ctua_ (5ctu A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2973214Fold d.122: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55873] (1 superfamily)
    8-stranded mixed beta-sheet; 2 layers: alpha/beta
  4. 2973215Superfamily d.122.1: ATPase domain of HSP90 chaperone/DNA topoisomerase II/histidine kinase [55874] (5 families) (S)
  5. 2973995Family d.122.1.0: automated matches [227160] (1 protein)
    not a true family
  6. 2973996Protein automated matches [226867] (22 species)
    not a true protein
  7. 2974158Species Staphylococcus aureus [TaxId:1280] [232247] (22 PDB entries)
  8. 2974165Domain d5ctua_: 5ctu A: [313370]
    Other proteins in same PDB: d5ctub2
    automated match to d3u2ka_
    protein/DNA complex; complexed with 54x, cl, mg, mpd

Details for d5ctua_

PDB Entry: 5ctu (more details), 1.45 Å

PDB Description: crystal structure of the atp binding domain of s. aureus gyrb complexed with a fragment
PDB Compounds: (A:) DNA gyrase subunit b

SCOPe Domain Sequences for d5ctua_:

Sequence; same for both SEQRES and ATOM records: (download)

>d5ctua_ d.122.1.0 (A:) automated matches {Staphylococcus aureus [TaxId: 1280]}
agqiqvlegleavrkrpgmyigstserglhhlvweivdnsidealagyanqievviekdn
wikvtdngrgipvdiqekmgrpaveviltssvvnalsqdlevyvhrnetiyhqaykkgvp
qfdlkevgttdktgtvirfkadgeiftettvynyetlqqrirelaflnkgiqitlrderd
eenvredsyhye

SCOPe Domain Coordinates for d5ctua_:

Click to download the PDB-style file with coordinates for d5ctua_.
(The format of our PDB-style files is described here.)

Timeline for d5ctua_: