Lineage for d1flca2 (1flc A:1-217,A:322-427)

  1. Root: SCOP 1.55
  2. 18352Class c: Alpha and beta proteins (a/b) [51349] (97 folds)
  3. 21773Fold c.23: Flavodoxin-like [52171] (16 superfamilies)
  4. 22164Superfamily c.23.10: Esterase/acetylhydrolase [52266] (4 families) (S)
  5. 22171Family c.23.10.2: Esterase domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [52270] (1 protein)
  6. 22172Protein Esterase domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [52271] (1 species)
  7. 22173Species Influenza C virus [TaxId:11552] [52272] (1 PDB entry)
  8. 22174Domain d1flca2: 1flc A:1-217,A:322-427 [31337]
    Other proteins in same PDB: d1flca1, d1flcb_, d1flcc1, d1flcd_, d1flce1, d1flcf_

Details for d1flca2

PDB Entry: 1flc (more details), 3.2 Å

PDB Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus

SCOP Domain Sequences for d1flca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flca2 c.23.10.2 (A:1-217,A:322-427) Esterase domain of haemagglutinin-esterase-fusion glycoprotein HEF1 {Influenza C virus}
ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
haaincyrknwtdiklnfqkniyelasqshcmslvnaldktiplqvtagtagncnnsflk
npalytqevkpsenkcgkenlafftlptqfgtyecklXresdyavdqaclstpgcmliqk
qkpyigeaddhhgdqemrellsgldyearcisqsgwvnetspftekyllppkfgrcplaa
keesipkipdglliptsgtdttvt

SCOP Domain Coordinates for d1flca2:

Click to download the PDB-style file with coordinates for d1flca2.
(The format of our PDB-style files is described here.)

Timeline for d1flca2: