Lineage for d1flca2 (1flc A:1-150,A:307-427)

  1. Root: SCOPe 2.07
  2. 2413226Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2438294Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2440037Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2440044Family c.23.10.2: Esterase domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [52270] (1 protein)
  6. 2440045Protein Esterase domain of haemagglutinin-esterase-fusion glycoprotein HEF1 [52271] (1 species)
    includes irregular N- and C-terminal extensions
  7. 2440046Species Influenza C virus [TaxId:11552] [52272] (1 PDB entry)
  8. 2440047Domain d1flca2: 1flc A:1-150,A:307-427 [31337]
    Other proteins in same PDB: d1flca1, d1flcb_, d1flcc1, d1flcd_, d1flce1, d1flcf_
    complexed with bma, man, nag, ndg

Details for d1flca2

PDB Entry: 1flc (more details), 3.2 Å

PDB Description: x-ray structure of the haemagglutinin-esterase-fusion glycoprotein of influenza c virus
PDB Compounds: (A:) haemagglutinin-esterase-fusion glycoprotein

SCOPe Domain Sequences for d1flca2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1flca2 c.23.10.2 (A:1-150,A:307-427) Esterase domain of haemagglutinin-esterase-fusion glycoprotein HEF1 {Influenza C virus [TaxId: 11552]}
ekikiclqkqvnssfslhngfggnlyateekrmfelvkpkagasvlnqstwigfgdsrtd
ksnsafprsadvsaktadkfrflsggslmlsmfgppgkvdylyqgcgkhkvfyegvnwsp
haaincyrknwtdiklnfqkniyelasqshXekgpvtavqsiwgkgresdyavdqaclst
pgcmliqkqkpyigeaddhhgdqemrellsgldyearcisqsgwvnetspftekyllppk
fgrcplaakeesipkipdglliptsgtdttvt

SCOPe Domain Coordinates for d1flca2:

Click to download the PDB-style file with coordinates for d1flca2.
(The format of our PDB-style files is described here.)

Timeline for d1flca2: