SCOPe 2.08: Domain d5d93e2: 5d93 E:106-212

Lineage for d5d93e2 (5d93 E:106-212)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.1: Immunoglobulin [48726] (5 families)

5. Family b.1.1.2: C1 set domains (antibody constant domain-like) [48942] (24 proteins)

6. Protein automated matches [190374] (15 species)
   not a true protein

7. Species Mouse (Mus musculus) [TaxId:10090] [224855] (650 PDB entries)

8. Domain d5d93e2: 5d93 E:106-212 [313367]
   Other proteins in same PDB: d5d93b1, d5d93c1, d5d93c2, d5d93e1, d5d93f1, d5d93f2
   automated match to d1dn0a2

Details for d5d93e2

PDB Entry: 5d93, 2.2 Å

PDB Description: oxidoreductase fragment of mouse qsox1 in complex with a fab fragment from a mouse qsox1-specific antibody

PDB Compounds: (E:) Light Chain of Fab Fragment from a Mouse QSOX1-Specific Antibody

SCOPe Domain Sequences for d5d93e2:

Sequence; same for both SEQRES and ATOM records:

>d5d93e2 b.1.1.2 (E:106-212) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
krtvaapsvfifppsdeqlksgtasvvcllnnfypreakvqwkvdnalqsgnsqesvteq
dskdstyslsstltlskadyekhkvyacevthqglsspvtksfnrge

Timeline for d5d93e2:

• d5d93e2 first appeared in SCOPe 2.06
  
• d5d93e2 appears in SCOPe 2.07