Lineage for d1ese__ (1ese -)
- Root: SCOP 1.55
Class c: Alpha and beta proteins (a/b) [51349] (97 folds) 
Fold c.23: Flavodoxin-like [52171] (16 superfamilies) 
Superfamily c.23.10: Esterase/acetylhydrolase [52266] (4 families) 
Family c.23.10.1: Esterase [52267] (1 protein) Protein Esterase [52268] (1 species) Species Streptomyces scabies [TaxId:1930] [52269] (3 PDB entries) 
Domain d1ese__: 1ese - [31336]
Details for d1ese__
PDB Entry: 1ese (more details), 2.4 Å
PDB Description: the molecular mechanism of enantiorecognition by esterases
SCOP Domain Sequences for d1ese__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ese__ c.23.10.1 (-) Esterase {Streptomyces scabies}
dpvptvffgdsytanfgiapvtnqdsergwcfqakenypavatrsladkgitldvqadvs
cggalihhfwekqelpfgagelppqqdalkqdtqltvgslggntlgfnrilkqcsdelrk
psllpgdpvdgdepaakcgeffgtgdgkqwlddqfervgaeleelldrigyfapdakrvl
vgyprlvpedttkcltaapgqtqlpfadipqdalpvldqiqkrlndamkkaaadggadfv
dlyagtgantacdgadrgigglledsqlellgtkipwyahpndkgrdiqakqvadkieei
ln
SCOP Domain Coordinates for d1ese__:
Click to download the PDB-style file with coordinates for d1ese__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1ese__:
- d1ese__ appears in SCOP 1.57
- d1ese__ appears in the current release, SCOPe 2.08, called d1esea_
View in 3D