SCOPe 2.08: Domain d1esea_: 1ese A:

Lineage for d1esea_ (1ese A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
   3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345

4. Superfamily c.23.10: SGNH hydrolase [52266] (10 families)

5. Family c.23.10.1: Esterase [52267] (1 protein)

6. Protein Esterase [52268] (1 species)

7. Species Streptomyces scabies [TaxId:1930] [52269] (3 PDB entries)

8. Domain d1esea_: 1ese A: [31336]
   complexed with dep

Details for d1esea_

PDB Entry: 1ese, 2.4 Å

PDB Description: the molecular mechanism of enantiorecognition by esterases

PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d1esea_:

Sequence; same for both SEQRES and ATOM records:

>d1esea_ c.23.10.1 (A:) Esterase {Streptomyces scabies [TaxId: 1930]}
dpvptvffgdsytanfgiapvtnqdsergwcfqakenypavatrsladkgitldvqadvs
cggalihhfwekqelpfgagelppqqdalkqdtqltvgslggntlgfnrilkqcsdelrk
psllpgdpvdgdepaakcgeffgtgdgkqwlddqfervgaeleelldrigyfapdakrvl
vgyprlvpedttkcltaapgqtqlpfadipqdalpvldqiqkrlndamkkaaadggadfv
dlyagtgantacdgadrgigglledsqlellgtkipwyahpndkgrdiqakqvadkieei
ln

Timeline for d1esea_:

• d1esea_ first appeared (with stable ids) in SCOP 1.55, called d1ese__
  
• d1esea_ appears in SCOPe 2.07