Lineage for d1esea_ (1ese A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2855423Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2857378Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2857379Family c.23.10.1: Esterase [52267] (1 protein)
  6. 2857380Protein Esterase [52268] (1 species)
  7. 2857381Species Streptomyces scabies [TaxId:1930] [52269] (3 PDB entries)
  8. 2857383Domain d1esea_: 1ese A: [31336]
    complexed with dep

Details for d1esea_

PDB Entry: 1ese (more details), 2.4 Å

PDB Description: the molecular mechanism of enantiorecognition by esterases
PDB Compounds: (A:) esterase

SCOPe Domain Sequences for d1esea_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1esea_ c.23.10.1 (A:) Esterase {Streptomyces scabies [TaxId: 1930]}
dpvptvffgdsytanfgiapvtnqdsergwcfqakenypavatrsladkgitldvqadvs
cggalihhfwekqelpfgagelppqqdalkqdtqltvgslggntlgfnrilkqcsdelrk
psllpgdpvdgdepaakcgeffgtgdgkqwlddqfervgaeleelldrigyfapdakrvl
vgyprlvpedttkcltaapgqtqlpfadipqdalpvldqiqkrlndamkkaaadggadfv
dlyagtgantacdgadrgigglledsqlellgtkipwyahpndkgrdiqakqvadkieei
ln

SCOPe Domain Coordinates for d1esea_:

Click to download the PDB-style file with coordinates for d1esea_.
(The format of our PDB-style files is described here.)

Timeline for d1esea_: