| Class b: All beta proteins [48724] (180 folds) |
| Fold b.6: Cupredoxin-like [49502] (2 superfamilies) sandwich; 7 strands in 2 sheets, greek-key variations: some members have additional 1-2 strands |
Superfamily b.6.1: Cupredoxins [49503] (8 families) ![]() contains copper-binding site |
| Family b.6.1.0: automated matches [191502] (1 protein) not a true family |
| Protein automated matches [190824] (31 species) not a true protein |
| Species Alcaligenes faecalis [TaxId:511] [226762] (16 PDB entries) |
| Domain d5d4jc1: 5d4j C:4-161 [313359] automated match to d1zdsa1 complexed with acy, cl, cu, gol |
PDB Entry: 5d4j (more details), 2 Å
SCOPe Domain Sequences for d5d4jc1:
Sequence; same for both SEQRES and ATOM records: (download)
>d5d4jc1 b.6.1.0 (C:4-161) automated matches {Alcaligenes faecalis [TaxId: 511]}
ataaeiaalprqkvelvdppfvhahsqvaeggpkvveftmvieekkividdagtevhama
fngtvpgplmvvhqddyleltlinpetntlmhnidfhaatgalgggglteinpgektilr
fkatkpgvfvyhcappgmvpwhvvsgmngaimvlpreg
Timeline for d5d4jc1:
View in 3DDomains from other chains: (mouse over for more information) d5d4ja1, d5d4ja2, d5d4jb1, d5d4jb2 |