SCOPe 2.08: Domain d5diua1: 5diu A:16-140

Lineage for d5diua1 (5diu A:16-140)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.26: FKBP-like [54533] (3 superfamilies)
   core: beta(2)-alpha-beta(2); antiparallel beta-sheet

4. Superfamily d.26.1: FKBP-like [54534] (4 families)

5. Family d.26.1.1: FKBP immunophilin/proline isomerase [54535] (17 proteins)

6. Protein automated matches [191209] (6 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [189839] (61 PDB entries)

8. Domain d5diua1: 5diu A:16-140 [313357]
   Other proteins in same PDB: d5diua2
   automated match to d4drha_
   complexed with 5bg

Details for d5diua1

PDB Entry: 5diu, 1.3 Å

PDB Description: the fk1 domain of fkbp51 in complex with the new synthetic ligand 2- (3-((r)-1-((s)-1-((s)-2-cyclohexyl-2-(3,4,5-trimethoxyphenyl)acetyl) piperidine-2-carboxamido)-3-(3,4-dimethoxyphenyl)propyl)phenoxy) acetic acid

PDB Compounds: (A:) Peptidyl-prolyl cis-trans isomerase FKBP5

SCOPe Domain Sequences for d5diua1:

Sequence; same for both SEQRES and ATOM records:

>d5diua1 d.26.1.1 (A:16-140) automated matches {Human (Homo sapiens) [TaxId: 9606]}
atvteqgeditskkdrgvlkivkrvgngeetpmigdkvyvhykgklsngkkfdsshdrne
pfvfslgkgqvikawdigvatmkkgeichllckpeyaygsagslpkipsnatlffeiell
dfkge

Timeline for d5diua1:

• d5diua1 first appeared in SCOPe 2.06, called d5diua_
  
• d5diua1 appears in SCOPe 2.07