SCOPe 2.06: Domain d5dc0a_: 5dc0 A:

Lineage for d5dc0a_ (5dc0 A:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
   sandwich; 7 strands in 2 sheets; greek-key
   some members of the fold have additional strands

4. Superfamily b.1.2: Fibronectin type III [49265] (2 families)

5. Family b.1.2.0: automated matches [191562] (1 protein)
   not a true family

6. Protein automated matches [190976] (4 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [188649] (54 PDB entries)

8. Domain d5dc0a_: 5dc0 A: [313355]
   Other proteins in same PDB: d5dc0b_
   automated match to d3uyod_

Details for d5dc0a_

PDB Entry: 5dc0

PDB Description: crystal structure of monobody gg3/abl1 sh2 domain complex

PDB Compounds: (A:) Fibronectin

SCOPe Domain Sequences for d5dc0a_:

Sequence; same for both SEQRES and ATOM records:

>d5dc0a_ b.1.2.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
dvptklevvaatptslliswdapavtvvhyvitygetggnspvqeftvpgskstatisgl
spgvdytitvyallssshwvyespisinyrt

Timeline for d5dc0a_:

• d5dc0a_ is new in SCOPe 2.06-stable
  
• d5dc0a_ appears in SCOPe 2.07
  
• d5dc0a_ appears in the current release, SCOPe 2.08