SCOPe 2.06: Domain d5d9zb_: 5d9z B:

Lineage for d5d9zb_ (5d9z B:)

1. Root: SCOPe 2.06

2. Class b: All beta proteins [48724] (177 folds)

3. Fold b.78: beta-Prism II [51109] (1 superfamily)
   consists of 3 4-stranded sheets; strands are perpendicular to the 3-fold axis
   duplication: consists of two domains of this fold

4. Superfamily b.78.1: alpha-D-mannose-specific plant lectins [51110] (2 families)

5. Family b.78.1.0: automated matches [191418] (1 protein)
   not a true family

6. Protein automated matches [190587] (7 species)
   not a true protein

7. Species Colocasia esculenta [TaxId:4460] [276542] (5 PDB entries)

8. Domain d5d9zb_: 5d9z B: [313349]
   automated match to d5d5gd_

Details for d5d9zb_

PDB Entry: 5d9z

PDB Description: structure of colocasia esculenta agglutinin with mannose bound

PDB Compounds: (B:) Tuber agglutinin

SCOPe Domain Sequences for d5d9zb_:

Sequence; same for both SEQRES and ATOM records:

>d5d9zb_ b.78.1.0 (B:) automated matches {Colocasia esculenta [TaxId: 4460]}
nipftnnllfsgqvlygdgrltakshqlvmqgdcnlvlyggkygwqsnthgngehcflrl
nhkgeliikdddfktiwsssssskhgdyvlilrddgfaviygpaiwetspqa

Timeline for d5d9zb_:

• d5d9zb_ is new in SCOPe 2.06-stable
  
• d5d9zb_ appears in SCOPe 2.07
  
• d5d9zb_ appears in the current release, SCOPe 2.08