Lineage for d5db3a2 (5db3 A:231-588)

  1. Root: SCOPe 2.06
  2. 1976409Class a: All alpha proteins [46456] (289 folds)
  3. 2009599Fold a.118: alpha-alpha superhelix [48370] (25 superfamilies)
    multihelical; 2 (curved) layers: alpha/alpha; right-handed superhelix
  4. 2010681Superfamily a.118.8: TPR-like [48452] (9 families) (S)
  5. 2010682Family a.118.8.1: Tetratricopeptide repeat (TPR) [48453] (20 proteins)
    this is a repeat family; one repeat unit is 1zb1 A:166-231 found in domain
  6. 2010721Protein Menin C-terminal domain [310725] (2 species)
  7. 2010722Species Human (Homo sapiens) [TaxId:9606] [310974] (23 PDB entries)
  8. 2010746Domain d5db3a2: 5db3 A:231-588 [313348]
    Other proteins in same PDB: d5db3a1
    automated match to d4gpqa2

Details for d5db3a2

PDB Entry: 5db3 (more details)

PDB Description: menin in complex with mi-574
PDB Compounds: (A:) Menin

SCOPe Domain Sequences for d5db3a2:

Sequence, based on SEQRES records: (download)

>d5db3a2 a.118.8.1 (A:231-588) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivsvpapaaspppegpvltfqsekmk
gmkellvatkinssaiklqltaqsqvqmk

Sequence, based on observed residues (ATOM records): (download)

>d5db3a2 a.118.8.1 (A:231-588) Menin C-terminal domain {Human (Homo sapiens) [TaxId: 9606]}
drkmevafmvcainpsidlhtdslellqlqqkllwllydlghlerypmalgnladleele
ptpgrpdpltlyhkgiasaktyyrdehiypymylagyhcrnrnvrealqawadtatviqd
ynycredeeiykeffevandvipnllkeaaslleagsqgsalqdpecfahllrfydgick
weegsptpvlhvgwatflvqslgrfegqvrqkvrivsgpvltfqsekmkgmkellvatki
nssaiklqltaqsqvqmk

SCOPe Domain Coordinates for d5db3a2:

Click to download the PDB-style file with coordinates for d5db3a2.
(The format of our PDB-style files is described here.)

Timeline for d5db3a2:

View in 3D
Domains from same chain:
(mouse over for more information)
d5db3a1